PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G091500.1.p
Common NameSb06g017660, SORBIDRAFT_06g017660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MIKC_MADS
Protein Properties Length: 206aa    MW: 23847.6 Da    PI: 9.6146
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G091500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF74.21.1e-231056248
                          ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
                SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                          +ien   rqvtf+kRr g+lKKA+ELSvLCda + vi++s++gk+y+
  Sobic.006G091500.1.p 10 KIENPVHRQVTFCKRRMGLLKKAKELSVLCDAAIGVIVISPHGKIYD 56
                          69*******************************************97 PP

2K-box58.62.7e-2077175498
                 K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGe....dLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelq 88 
                           + g+s +++k++  +qe+  L +ei+ Lq+  R + Ge    d++ ++l eLq Le++Le  +++iRs+K++++ ++ie l++ke +lq
  Sobic.006G091500.1.p  77 RPGESSNHNKTQIIKQEVLALTREIDLLQKGFRYMHGEnvenDINHMNLDELQTLENNLEMWVNSIRSQKMQIISREIEMLRNKEAMLQ 165
                           5566788899***************************955556899******************************************* PP

                 K-box  89 eenkaLrkkl 98 
                             n  L++++
  Sobic.006G091500.1.p 166 AVNGVLQERI 175
                           ****999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554554.45E-26174IPR002100Transcription factor, MADS-box
PROSITE profilePS5006627.88161IPR002100Transcription factor, MADS-box
SMARTSM004323.9E-32160IPR002100Transcription factor, MADS-box
CDDcd002658.07E-35273No hitNo description
PRINTSPR004047.5E-24323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.6E-221055IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-243859IPR002100Transcription factor, MADS-box
PfamPF014866.6E-2481175IPR002487Transcription factor, K-box
PROSITE profilePS5129712.97687182IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MARGKVQMRK IENPVHRQVT FCKRRMGLLK KAKELSVLCD AAIGVIVISP HGKIYDLATN  60
GNMQGLIERY RRTYSERPGE SSNHNKTQII KQEVLALTRE IDLLQKGFRY MHGENVENDI  120
NHMNLDELQT LENNLEMWVN SIRSQKMQII SREIEMLRNK EAMLQAVNGV LQERIIEQNG  180
ILNFSNTAMT PQTPFQLTME RNYYL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9761310.0EU976131.1 Zea mays clone 645550 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002447900.11e-147hypothetical protein SORBIDRAFT_06g017660
SwissprotA2YQK92e-69MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G82e-69MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLC5Y9571e-147C5Y957_SORBI; Putative uncharacterized protein Sb06g017660
STRINGSb06g017660.11e-147(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.11e-55AGAMOUS-like 12